SCOPe 2.02: Domain d1bngc_: 1bng C:

Lineage for d1bngc_ (1bng C:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein Barnase [81305] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (45 PDB entries)

8. Domain d1bngc_: 1bng C: [36186]
   mutant

Details for d1bngc_

PDB Entry: 1bng, 2.1 Å

PDB Description: barnase s85c/h102c disulfide mutant

PDB Compounds: (C:) barnase

SCOPe Domain Sequences for d1bngc_:

Sequence; same for both SEQRES and ATOM records:

>d1bngc_ d.1.1.2 (C:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
intfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregkl
pgksgrtwreadinytsgfrncdrilyssdwliykttdcyqtftkir

Timeline for d1bngc_:

• d1bngc_ first appeared (with stable ids) in SCOP 1.55
  
• d1bngc_ appears in SCOPe 2.01
  
• d1bngc_ appears in SCOPe 2.03
  
• d1bngc_ appears in the current release, SCOPe 2.08