Lineage for d6nddb_ (6ndd B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607280Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2607740Protein automated matches [190329] (10 species)
    not a true protein
  7. 2607803Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [188489] (10 PDB entries)
  8. 2607862Domain d6nddb_: 6ndd B: [361805]
    Other proteins in same PDB: d6nddc_, d6nddf_, d6nddi_, d6nddl_, d6nddo_, d6nddr_
    automated match to d1v7pb_
    complexed with cl, mn, na, nh4, so4

Details for d6nddb_

PDB Entry: 6ndd (more details), 3.05 Å

PDB Description: rhodocetin in complex with the integrin alpha2-a domain with manganese bound
PDB Compounds: (B:) Snaclec rhodocetin subunit delta

SCOPe Domain Sequences for d6nddb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nddb_ d.169.1.1 (B:) automated matches {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
kf

SCOPe Domain Coordinates for d6nddb_:

Click to download the PDB-style file with coordinates for d6nddb_.
(The format of our PDB-style files is described here.)

Timeline for d6nddb_: