SCOPe 2.08: Domain d6hlza1: 6hlz A:30-342

Lineage for d6hlza1 (6hlz A:30-342)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:1435057] [361667] (3 PDB entries)

8. Domain d6hlza1: 6hlz A:30-342 [361678]
   Other proteins in same PDB: d6hlza2, d6hlzb2, d6hlzb3
   automated match to d5l9sa_
   complexed with edo, g9z, p4g, p6g, peg

Details for d6hlza1

PDB Entry: 6hlz, 1.89 Å

PDB Description: structure in c2 form of the pbp agtb from a.tumefacien r10 in complex with agropinic acid

PDB Compounds: (A:) Agropine permease

SCOPe Domain Sequences for d6hlza1:

Sequence; same for both SEQRES and ATOM records:

>d6hlza1 c.94.1.0 (A:30-342) automated matches {Agrobacterium tumefaciens [TaxId: 1435057]}
adlvissyggsfqdaqtkayfdpyakasgvkvtgttgtgyakvkamvesgnvtwdvisae
spafasevkdgllepidysvvkadnvpenfrtkygvgymvfgtnlawnkdkfpngvtpaq
ffdpnvkgrrvlpsdatyslefalmgdgvkpadlypldvkralkvidrvkdqvigykgas
diqalmqqgeadivyagtgriknaikaganwsyswegaladteywavpkgaphaaeamkf
infavqaepqaeltrviaygptnvdalrlldpavakdlpsypanaklgavlnskwwndny
davkaewttyimq

Timeline for d6hlza1:

• d6hlza1 first appeared in SCOPe 2.07