Lineage for d5l9sa_ (5l9s A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) 
Similar in architecture to the superfamily I but partly differs in topology
Family c.94.1.0: automated matches [191309] (1 protein)
not a true familyProtein automated matches [190039] (161 species)
not a true protein
Species Agrobacterium fabrum [TaxId:176299] [258501] (12 PDB entries) 
Domain d5l9sa_: 5l9s A: [323064]
automated match to d4edpa_
complexed with act, edo
Details for d5l9sa_
PDB Entry: 5l9s (more details), 2.49 Å
PDB Description: structure of agrobacterium tumefaciens c58 strain pbp attc in open unliganded conformation
PDB Compounds: (A:) ABC transporter, substrate binding protein (Mannopine)SCOPe Domain Sequences for d5l9sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l9sa_ c.94.1.0 (A:) automated matches {Agrobacterium fabrum [TaxId: 176299]}
meqrvviattggtyekalreawfepftkatgikvvtvsgtdaekrakvtamvqtgnvtwd
lyldgeiqagsdahfaitedlsdfcmqfinstdlladsctrggaklqststllayklnen
gsnpqtwadmwdlakfpgarsfpnfddpwrvlaaalladgvpreklfpldvdrafrklde
lrdsvqvwwrtgdqsvqafrndeyrvgqiwltrakalkaegykigwsydgaflvgdrial
vrgapnrenalkliefwlrnpaaqakacetlsctppsqkaisqmssearatlpsaadven
riivpdaqwinanmgmlvqrwnswir
SCOPe Domain Coordinates for d5l9sa_:
Click to download the PDB-style file with coordinates for d5l9sa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5l9sa_:
- d5l9sa_ first appeared in SCOPe 2.06
- d5l9sa_ appears in SCOPe 2.07
View in 3D
