Lineage for d5l9sa_ (5l9s A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. Protein automated matches [190039] (160 species)
    not a true protein
  7. Species Agrobacterium fabrum [TaxId:176299] [258501] (12 PDB entries)
  8. Domain d5l9sa_: 5l9s A: [323064]
    automated match to d4edpa_
    complexed with act, edo

Details for d5l9sa_

PDB Entry: 5l9s (more details), 2.4899999999999998 Å

PDB Description: structure of agrobacterium tumefaciens c58 strain pbp attc in open unliganded conformation
PDB Compounds: (A:) ABC transporter, substrate binding protein (Mannopine)

SCOPe Domain Sequences for d5l9sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l9sa_ c.94.1.0 (A:) automated matches {Agrobacterium fabrum [TaxId: 176299]}
meqrvviattggtyekalreawfepftkatgikvvtvsgtdaekrakvtamvqtgnvtwd
lyldgeiqagsdahfaitedlsdfcmqfinstdlladsctrggaklqststllayklnen
gsnpqtwadmwdlakfpgarsfpnfddpwrvlaaalladgvpreklfpldvdrafrklde
lrdsvqvwwrtgdqsvqafrndeyrvgqiwltrakalkaegykigwsydgaflvgdrial
vrgapnrenalkliefwlrnpaaqakacetlsctppsqkaisqmssearatlpsaadven
riivpdaqwinanmgmlvqrwnswir

SCOPe Domain Coordinates for d5l9sa_ are not available.

Timeline for d5l9sa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5l9sb_