Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.3: GABARAP-like [54253] (4 proteins) intracellular membrane trafficking and fusion proteins automatically mapped to Pfam PF02991 |
Protein GABA(A) receptor associated protein GABARAP [69658] (3 species) |
Species Mus musculus [TaxId:10090] [352623] (2 PDB entries) |
Domain d6a9xd_: 6a9x D: [361615] automated match to d1gnua_ |
PDB Entry: 6a9x (more details), 2.2 Å
SCOPe Domain Sequences for d6a9xd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6a9xd_ d.15.1.3 (D:) GABA(A) receptor associated protein GABARAP {Mus musculus [TaxId: 10090]} mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl
Timeline for d6a9xd_: