Lineage for d6a9xd_ (6a9x D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2539843Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
    automatically mapped to Pfam PF02991
  6. 2539844Protein GABA(A) receptor associated protein GABARAP [69658] (3 species)
  7. 2539859Species Mus musculus [TaxId:10090] [352623] (2 PDB entries)
  8. 2539860Domain d6a9xd_: 6a9x D: [361615]
    automated match to d1gnua_

Details for d6a9xd_

PDB Entry: 6a9x (more details), 2.2 Å

PDB Description: crystal structure of ankg/gabarap complex
PDB Compounds: (D:) Gamma-aminobutyric acid receptor-associated protein

SCOPe Domain Sequences for d6a9xd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a9xd_ d.15.1.3 (D:) GABA(A) receptor associated protein GABARAP {Mus musculus [TaxId: 10090]}
mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl

SCOPe Domain Coordinates for d6a9xd_:

Click to download the PDB-style file with coordinates for d6a9xd_.
(The format of our PDB-style files is described here.)

Timeline for d6a9xd_: