SCOPe 2.06: Domain d1hz1a_: 1hz1 A:

Lineage for d1hz1a_ (1hz1 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins)

6. Protein RNase T1 [53939] (2 species)

7. Species Aspergillus niger [TaxId:5061] [53941] (1 PDB entry)

8. Domain d1hz1a_: 1hz1 A: [36138]
   complexed with 2gp, mg; mutant

Details for d1hz1a_

PDB Entry: 1hz1, 1.8 Å

PDB Description: ribonuclease t1 v16a mutant in complex with mg2+

PDB Compounds: (A:) ribonuclease t1

SCOPe Domain Sequences for d1hz1a_:

Sequence; same for both SEQRES and ATOM records:

>d1hz1a_ d.1.1.4 (A:) RNase T1 {Aspergillus niger [TaxId: 5061]}
acdytcgsncysssdastaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

Timeline for d1hz1a_:

• d1hz1a_ first appeared (with stable ids) in SCOP 1.55
  
• d1hz1a_ appears in SCOPe 2.05
  
• d1hz1a_ appears in SCOPe 2.07
  
• d1hz1a_ appears in the current release, SCOPe 2.08