Lineage for d5rnta_ (5rnt A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530963Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2530964Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2531209Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins)
  6. 2531220Protein RNase T1 [53939] (2 species)
  7. 2531223Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries)
  8. 2531322Domain d5rnta_: 5rnt A: [36136]
    complexed with pgp

Details for d5rnta_

PDB Entry: 5rnt (more details), 3.2 Å

PDB Description: x-ray analysis of cubic crystals of the complex formed between ribonuclease t1 and guanosine-3',5'-bisphosphate
PDB Compounds: (A:) ribonuclease t1

SCOPe Domain Sequences for d5rnta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5rnta_ d.1.1.4 (A:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

SCOPe Domain Coordinates for d5rnta_:

Click to download the PDB-style file with coordinates for d5rnta_.
(The format of our PDB-style files is described here.)

Timeline for d5rnta_: