SCOPe 2.04: Domain d1rn1b_: 1rn1 B:

Lineage for d1rn1b_ (1rn1 B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins)

6. Protein RNase T1 [53939] (2 species)

7. Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries)

8. Domain d1rn1b_: 1rn1 B: [36123]
   complexed with so4

Details for d1rn1b_

PDB Entry: 1rn1, 1.84 Å

PDB Description: three-dimensional structure of gln 25-ribonuclease t1 at 1.84 angstroms resolution: structural variations at the base recognition and catalytic sites

PDB Compounds: (B:) ribonuclease t1 isozyme

SCOPe Domain Sequences for d1rn1b_:

Sequence; same for both SEQRES and ATOM records:

>d1rn1b_ d.1.1.4 (B:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
cdytcgsncysssdvstaqaagyqlhedgetvgsnsyphkynnyegfdfsvsspyyewpi
lssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

Timeline for d1rn1b_:

• d1rn1b_ first appeared (with stable ids) in SCOP 1.55
  
• d1rn1b_ appears in SCOPe 2.03
  
• d1rn1b_ appears in SCOPe 2.05
  
• d1rn1b_ appears in the current release, SCOPe 2.08