Lineage for d6f9qb_ (6f9q B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847854Species Nepeta racemosa [TaxId:213401] [361088] (1 PDB entry)
  8. 2847856Domain d6f9qb_: 6f9q B: [361139]
    automated match to d1ybva_
    complexed with cl, nad

Details for d6f9qb_

PDB Entry: 6f9q (more details), 1.4 Å

PDB Description: binary complex of a 7s-cis-cis-nepetalactol cyclase from nepeta mussinii with nad+
PDB Compounds: (B:) 7S-cis-cis-nepetalactol cyclase

SCOPe Domain Sequences for d6f9qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f9qb_ c.2.1.0 (B:) automated matches {Nepeta racemosa [TaxId: 213401]}
kkklegkvaivtggasgigeatarlfvkygaravviadiqselgrsvaesigkercsfvq
cdvadeeqvksmiewtattyggldvmfsnagvlnsaaqtvkdldlplfdkvmrvntrgaa
vcvkqaarkmvelgrggsiicnagssavrgahgvtdyvmskhaviglvrsasmqlgahsi
rvnsvspmavatpltrnqgistpddvqkflmpfislkgvpptaeqvaeaaaflgsdeaaf
vtghdlpvdggvlcmpf

SCOPe Domain Coordinates for d6f9qb_:

Click to download the PDB-style file with coordinates for d6f9qb_.
(The format of our PDB-style files is described here.)

Timeline for d6f9qb_: