SCOPe 2.04: Domain d7gspb_: 7gsp B:

Lineage for d7gspb_ (7gsp B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins)

6. Protein RNase T1 [53939] (2 species)

7. Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries)

8. Domain d7gspb_: 7gsp B: [36109]
   complexed with po4, sgp

Details for d7gspb_

PDB Entry: 7gsp, 2 Å

PDB Description: ribonuclease t1/2',3'-cgps, non-productive

PDB Compounds: (B:) ribonuclease t1

SCOPe Domain Sequences for d7gspb_:

Sequence; same for both SEQRES and ATOM records:

>d7gspb_ d.1.1.4 (B:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

Timeline for d7gspb_:

• d7gspb_ first appeared (with stable ids) in SCOP 1.55
  
• d7gspb_ appears in SCOPe 2.03
  
• d7gspb_ appears in SCOPe 2.05
  
• d7gspb_ appears in the current release, SCOPe 2.08