SCOPe 2.07: Domain d6bu2b1: 6bu2 B:8-152

Lineage for d6bu2b1 (6bu2 B:8-152)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [361033] (1 PDB entry)

8. Domain d6bu2b1: 6bu2 B:8-152 [361034]
   Other proteins in same PDB: d6bu2a2, d6bu2b2
   automated match to d1jc5b_
   complexed with so4

Details for d6bu2b1

PDB Entry: 6bu2, 2 Å

PDB Description: crystal structure of methylmalonyl-coa epimerase from mycobacterium tuberculosis

PDB Compounds: (B:) glyoxalase

SCOPe Domain Sequences for d6bu2b1:

Sequence; same for both SEQRES and ATOM records:

>d6bu2b1 d.32.1.0 (B:8-152) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
harhmlatslvtgldhvgiavadldvaiewyhdhlgmilvheeinddqgireallavpgs
aaqiqlmapldessviakfldkrgpgiqqlacrvsdldamcrrlrsqgvrlvyetarrgt
ansrinfihpkdaggvlielvepap

Timeline for d6bu2b1:

• d6bu2b1 is new in SCOPe 2.07-stable
  
• d6bu2b1 appears in the current release, SCOPe 2.08