Lineage for d6c89b_ (6c89 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997604Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2997605Protein automated matches [190418] (31 species)
    not a true protein
  7. 2997639Species Escherichia coli [TaxId:562] [226145] (21 PDB entries)
  8. 2997655Domain d6c89b_: 6c89 B: [361012]
    automated match to d4u4lb_
    complexed with cl, edo, gol, na, zn

Details for d6c89b_

PDB Entry: 6c89 (more details), 1.75 Å

PDB Description: ndm-1 beta-lactamase exhibits differential active site sequence requirements for the hydrolysis of penicillin versus carbapenem antibiotics
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d6c89b_:

Sequence, based on SEQRES records: (download)

>d6c89b_ d.157.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
gdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqi
lnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsl
tfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclirdskakslaql
gdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

Sequence, based on observed residues (ATOM records): (download)

>d6c89b_ d.157.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
gdqrfgdlvfrqlapnvwqhtsyldmpgavasnglivrdggrvlvvdtawtddqtaqiln
wikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsltf
aangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclirdskakslaqlgd
adtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d6c89b_:

Click to download the PDB-style file with coordinates for d6c89b_.
(The format of our PDB-style files is described here.)

Timeline for d6c89b_: