![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) ![]() |
![]() | Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
![]() | Protein automated matches [190418] (31 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [226145] (21 PDB entries) |
![]() | Domain d6c89b_: 6c89 B: [361012] automated match to d4u4lb_ complexed with cl, edo, gol, na, zn |
PDB Entry: 6c89 (more details), 1.75 Å
SCOPe Domain Sequences for d6c89b_:
Sequence, based on SEQRES records: (download)
>d6c89b_ d.157.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]} gdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqi lnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsl tfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclirdskakslaql gdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
>d6c89b_ d.157.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]} gdqrfgdlvfrqlapnvwqhtsyldmpgavasnglivrdggrvlvvdtawtddqtaqiln wikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsltf aangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclirdskakslaqlgd adtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
Timeline for d6c89b_: