Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) |
Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins) |
Protein RNase T1 [53939] (2 species) |
Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries) |
Domain d5hohc_: 5hoh C: [36098] complexed with 2gp, ca; mutant |
PDB Entry: 5hoh (more details), 2 Å
SCOPe Domain Sequences for d5hohc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hohc_ d.1.1.4 (C:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]} acdytcgsacysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp ilssgdvysggspgadrvvfnennqlagvithagasgnnfvect
Timeline for d5hohc_: