SCOPe 2.04: Domain d1rhla_: 1rhl A:

Lineage for d1rhla_ (1rhl A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins)

6. Protein RNase T1 [53939] (2 species)

7. Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries)

8. Domain d1rhla_: 1rhl A: [36082]
   complexed with 2gp, ca; mutant

Details for d1rhla_

PDB Entry: 1rhl, 1.95 Å

PDB Description: ribonuclease t1 complexed with 2'gmp/g23a mutant

PDB Compounds: (A:) protein (ribonuclease t1)

SCOPe Domain Sequences for d1rhla_:

Sequence; same for both SEQRES and ATOM records:

>d1rhla_ d.1.1.4 (A:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
acdytcgsncysssdvstaqaaayklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

Timeline for d1rhla_:

• d1rhla_ first appeared (with stable ids) in SCOP 1.55
  
• d1rhla_ appears in SCOPe 2.03
  
• d1rhla_ appears in SCOPe 2.05
  
• d1rhla_ appears in the current release, SCOPe 2.08