SCOPe 2.08: Domain d6n32l2: 6n32 L:107-213

Lineage for d6n32l2 (6n32 L:107-213)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d6n32l2: 6n32 L:107-213 [360749]
Other proteins in same PDB: d6n32h1, d6n32h2, d6n32k1, d6n32k2, d6n32l1, d6n32m1
automated match to d3cfja2
complexed with so4

Details for d6n32l2

PDB Entry: 6n32 (more details), 2.2 Å

PDB Description: anti-hiv-1 fab 2g12 re-refinement

PDB Compounds: (L:) Fab 2G12 light chain

SCOPe Domain Sequences for d6n32l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n32l2 b.1.1.2 (L:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d6n32l2:

Click to download the PDB-style file with coordinates for d6n32l2.
(The format of our PDB-style files is described here.)

Timeline for d6n32l2: