Lineage for d6n32m1 (6n32 M:1-106)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1180 PDB entries)
  8. 3060677Domain d6n32m1: 6n32 M:1-106 [360739]
    Other proteins in same PDB: d6n32h1, d6n32h2, d6n32k1, d6n32k2, d6n32l2, d6n32m2
    automated match to d3cfja1
    complexed with so4

Details for d6n32m1

PDB Entry: 6n32 (more details), 2.2 Å

PDB Description: anti-hiv-1 fab 2g12 re-refinement
PDB Compounds: (M:) Fab 2G12 light chain

SCOPe Domain Sequences for d6n32m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n32m1 b.1.1.0 (M:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrvei

SCOPe Domain Coordinates for d6n32m1:

Click to download the PDB-style file with coordinates for d6n32m1.
(The format of our PDB-style files is described here.)

Timeline for d6n32m1:

  • d6n32m1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-29