SCOPe 2.07: Domain d2gspa_: 2gsp A:

Lineage for d2gspa_ (2gsp A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins)

6. Protein RNase T1 [53939] (2 species)

7. Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries)

8. Domain d2gspa_: 2gsp A: [36064]
   complexed with ca, sgp

Details for d2gspa_

PDB Entry: 2gsp, 1.8 Å

PDB Description: ribonuclease t1/2',3'-cgps and 3'-gmp, 2 days

PDB Compounds: (A:) ribonuclease t1

SCOPe Domain Sequences for d2gspa_:

Sequence; same for both SEQRES and ATOM records:

>d2gspa_ d.1.1.4 (A:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

Timeline for d2gspa_:

• d2gspa_ first appeared (with stable ids) in SCOP 1.55, called d2gsp__
  
• d2gspa_ appears in SCOPe 2.06
  
• d2gspa_ appears in the current release, SCOPe 2.08