Lineage for d1rga__ (1rga -)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.1: Microbial ribonucleases [53932] (1 superfamily) Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) 
Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins) 
Protein RNase T1 [53939] (2 species) Species Aspergillus oryzae [TaxId:5062] [53940] (62 PDB entries) 
Domain d1rga__: 1rga - [36056]
Details for d1rga__
PDB Entry: 1rga (more details), 1.7 Å
PDB Description: crystal structure of rnase t1 with 3'-gmp and guanosine: a product complex
SCOP Domain Sequences for d1rga__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rga__ d.1.1.1 (-) RNase T1 {Aspergillus oryzae}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect
SCOP Domain Coordinates for d1rga__:
Click to download the PDB-style file with coordinates for d1rga__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rga__:
- d1rga__ first appeared (with stable ids) in SCOP 1.55
- d1rga__ appears in SCOP 1.59
- d1rga__ appears in SCOP 1.63
- d1rga__ appears in the current release, SCOPe 2.08, called d1rgaa_
View in 3D