Lineage for d5yt1a_ (5yt1 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2941124Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [267983] (3 PDB entries)
  8. 2941132Domain d5yt1a_: 5yt1 A: [360514]
    automated match to d3neda_

Details for d5yt1a_

PDB Entry: 5yt1 (more details), 2 Å

PDB Description: crystal structrure of near infrared fluoresecent protein mneptune684
PDB Compounds: (A:) near infrared fluoresecent protein mNeptune684

SCOPe Domain Sequences for d5yt1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yt1a_ d.22.1.0 (A:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
geelikenmhmklymegtvnnhhfkctsegegkpyegtqtqrikvveggplpfafdilat
cfmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvk
irgvnfpsngpvmqkktlgweantetlypadgglrghnpmalklvggghlicnlkttyrs
kkpaknlkmpgvyfvdrrlerikeadnetyveqhevavarycdlpsklg

SCOPe Domain Coordinates for d5yt1a_:

Click to download the PDB-style file with coordinates for d5yt1a_.
(The format of our PDB-style files is described here.)

Timeline for d5yt1a_: