PDB entry 5yt1

View 5yt1 on RCSB PDB site
Description: Crystal structrure of near infrared fluoresecent protein mNeptune684
Class: fluorescent protein
Keywords: mNeptune, near infrared fluorescent protein, FLUORESCENT PROTEIN
Deposited on 2017-11-16, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: near infrared fluoresecent protein mNeptune684
    Species: Entacmaea quadricolor [TaxId:6118]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YT1
    Domains in SCOPe 2.07: d5yt1a_
  • Chain 'B':
    Compound: near infrared fluoresecent protein mNeptune684
    Species: Entacmaea quadricolor [TaxId:6118]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YT1
    Domains in SCOPe 2.07: d5yt1b_
  • Chain 'C':
    Compound: near infrared fluoresecent protein mNeptune684
    Species: Entacmaea quadricolor [TaxId:6118]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YT1
    Domains in SCOPe 2.07: d5yt1c_
  • Chain 'D':
    Compound: near infrared fluoresecent protein mNeptune684
    Species: Entacmaea quadricolor [TaxId:6118]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YT1
    Domains in SCOPe 2.07: d5yt1d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yt1A (A:)
    mrgshhhhhhgsmvskgeelikenmhmklymegtvnnhhfkctsegegkpyegtqtqrik
    vveggplpfafdilatcfmygsktfinhtqgipdffkqsfpegftwervttyedggvlta
    tqdtslqdgcliynvkirgvnfpsngpvmqkktlgweantetlypadgglrghnpmalkl
    vggghlicnlkttyrskkpaknlkmpgvyfvdrrlerikeadnetyveqhevavarycdl
    psklghklngmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yt1A (A:)
    geelikenmhmklymegtvnnhhfkctsegegkpyegtqtqrikvveggplpfafdilat
    cfmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvk
    irgvnfpsngpvmqkktlgweantetlypadgglrghnpmalklvggghlicnlkttyrs
    kkpaknlkmpgvyfvdrrlerikeadnetyveqhevavarycdlpsklg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yt1B (B:)
    mrgshhhhhhgsmvskgeelikenmhmklymegtvnnhhfkctsegegkpyegtqtqrik
    vveggplpfafdilatcfmygsktfinhtqgipdffkqsfpegftwervttyedggvlta
    tqdtslqdgcliynvkirgvnfpsngpvmqkktlgweantetlypadgglrghnpmalkl
    vggghlicnlkttyrskkpaknlkmpgvyfvdrrlerikeadnetyveqhevavarycdl
    psklghklngmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yt1B (B:)
    eelikenmhmklymegtvnnhhfkctsegegkpyegtqtqrikvveggplpfafdilatc
    fmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvki
    rgvnfpsngpvmqkktlgweantetlypadgglrghnpmalklvggghlicnlkttyrsk
    kpaknlkmpgvyfvdrrlerikeadnetyveqhevavarycdlpsklg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yt1C (C:)
    mrgshhhhhhgsmvskgeelikenmhmklymegtvnnhhfkctsegegkpyegtqtqrik
    vveggplpfafdilatcfmygsktfinhtqgipdffkqsfpegftwervttyedggvlta
    tqdtslqdgcliynvkirgvnfpsngpvmqkktlgweantetlypadgglrghnpmalkl
    vggghlicnlkttyrskkpaknlkmpgvyfvdrrlerikeadnetyveqhevavarycdl
    psklghklngmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yt1C (C:)
    eelikenmhmklymegtvnnhhfkctsegegkpyegtqtqrikvveggplpfafdilatc
    fmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvki
    rgvnfpsngpvmqkktlgweantetlypadgglrghnpmalklvggghlicnlkttyrsk
    kpaknlkmpgvyfvdrrlerikeadnetyveqhevavarycdlpsklg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yt1D (D:)
    mrgshhhhhhgsmvskgeelikenmhmklymegtvnnhhfkctsegegkpyegtqtqrik
    vveggplpfafdilatcfmygsktfinhtqgipdffkqsfpegftwervttyedggvlta
    tqdtslqdgcliynvkirgvnfpsngpvmqkktlgweantetlypadgglrghnpmalkl
    vggghlicnlkttyrskkpaknlkmpgvyfvdrrlerikeadnetyveqhevavarycdl
    psklghklngmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yt1D (D:)
    eelikenmhmklymegtvnnhhfkctsegegkpyegtqtqrikvveggplpfafdilatc
    fmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvki
    rgvnfpsngpvmqkktlgweantetlypadgglrghnpmalklvggghlicnlkttyrsk
    kpaknlkmpgvyfvdrrlerikeadnetyveqhevavarycdlpsklg