SCOPe 2.06: Domain d2sarb_: 2sar B:

Lineage for d2sarb_ (2sar B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein RNase Sa [53935] (1 species)

7. Species Streptomyces aureofaciens [TaxId:1894] [53936] (22 PDB entries)
   Uniprot P05798

8. Domain d2sarb_: 2sar B: [36045]
   complexed with 3gp, so4

Details for d2sarb_

PDB Entry: 2sar, 1.8 Å

PDB Description: determination and restrained least-squares refinement of the crystal structures of ribonuclease sa and its complex with 3'-guanylic acid at 1.8 angstroms resolution

PDB Compounds: (B:) ribonuclease sa

SCOPe Domain Sequences for d2sarb_:

Sequence; same for both SEQRES and ATOM records:

>d2sarb_ d.1.1.2 (B:) RNase Sa {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriicgeatqedyytgdhyatfslidqtc

Timeline for d2sarb_:

• d2sarb_ first appeared (with stable ids) in SCOP 1.55
  
• d2sarb_ appears in SCOPe 2.05
  
• d2sarb_ appears in SCOPe 2.07
  
• d2sarb_ appears in the current release, SCOPe 2.08