Lineage for d6bnza2 (6bnz A:153-290)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/betaSuperfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) 
Family d.32.1.0: automated matches [191344] (1 protein)
not a true familyProtein automated matches [190239] (26 species)
not a true protein
Species Zea mays [TaxId:4577] [360358] (3 PDB entries) 
Domain d6bnza2: 6bnz A:153-290 [360366]
automated match to d4mtsa_
complexed with co, fmt, gsh; mutant
Details for d6bnza2
PDB Entry: 6bnz (more details), 1.45 Å
PDB Description: crystal structure of e144q-glyoxalase i mutant from zea mays in space group p4(1)2(1)2
PDB Compounds: (A:) lactoylglutathione lyaseSCOPe Domain Sequences for d6bnza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bnza2 d.32.1.0 (A:153-290) automated matches {Zea mays [TaxId: 4577]}
eplcqvmlrvgdlersikfyekalgmkllrkkdvpdykytiamlgyadedkttvleltyn
ygvteyskgnayaqvaigtndvyksaeavdlatkelggkilrqpgplpgintkiasfvdp
dgwkvvlvdntdflkelh
SCOPe Domain Coordinates for d6bnza2:
Click to download the PDB-style file with coordinates for d6bnza2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6bnza2:
- d6bnza2 is new in SCOPe 2.07-stable
- d6bnza2 appears in the current release, SCOPe 2.08
View in 3D
