Lineage for d6mx2i_ (6mx2 I:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2460578Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2460794Protein automated matches [190149] (15 species)
    not a true protein
  7. 2461149Species Peptoclostridium difficile [TaxId:272563] [360251] (1 PDB entry)
  8. 2461158Domain d6mx2i_: 6mx2 I: [360319]
    automated match to d1yg6a_
    complexed with gol, na

Details for d6mx2i_

PDB Entry: 6mx2 (more details), 2.5 Å

PDB Description: crystal structure of clpp1 from clostridium difficile 630.
PDB Compounds: (I:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d6mx2i_:

Sequence, based on SEQRES records: (download)

>d6mx2i_ c.14.1.1 (I:) automated matches {Peptoclostridium difficile [TaxId: 272563]}
alvpvvveqtgrgersydifsrllkdriiflgdqvndataglivaqllfleaedpdkdih
lyinspggsitsgmaiydtmqyikpdvsticigmaasmgafllaagakgkrlalpnseim
ihqplggaqgqatdieihakrilkiketlneilsertgqplekikmdterdnfmsaleak
eyglidevftkr

Sequence, based on observed residues (ATOM records): (download)

>d6mx2i_ c.14.1.1 (I:) automated matches {Peptoclostridium difficile [TaxId: 272563]}
alvpydifsrllkdriiflgdqvndataglivaqllfleaedpdkdihlyinspggsits
gmaiydtmqyikpdvsticigmaasmgafllaagakgkrlalpnseimihqplggaqgqa
tdieihakrilkiketlneilsertgqplekikmdterdnfmsaleakeyglidevftkr

SCOPe Domain Coordinates for d6mx2i_:

Click to download the PDB-style file with coordinates for d6mx2i_.
(The format of our PDB-style files is described here.)

Timeline for d6mx2i_: