Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (58 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries) |
Domain d6myae1: 6mya E:2-324 [360311] Other proteins in same PDB: d6myaa2, d6myaa3, d6myab2, d6myac2, d6myad2, d6myae2, d6myae3, d6myaf2 automated match to d4wsrd1 complexed with edo, nag, peg |
PDB Entry: 6mya (more details), 2.05 Å
SCOPe Domain Sequences for d6myae1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6myae1 b.19.1.0 (E:2-324) automated matches {Influenza A virus, different strains [TaxId: 11320]} sdticigyhannstdtvdtlleknvtvthsvnlledshngklcklkgiaplqlgkcniag wllgnpecdsllparswsyivetpnsengacypgdfidyeelkeqlssvsslerfeifpk esswpnhntlkgvtascshggkssfyrnllwltktgdsypkltnsyvnnkgkevlvlwgv hhpsssneqqslyhnvnayvsvvssnynrrftpeiaarpkvrdqpgrmnyywtllepgdt iifeatgnliapwyafalsrgfgssiiisnasmhecntkcqtpqgainsslpfqnihpvt igecpkyvrstklrmvtglrnip
Timeline for d6myae1: