Lineage for d6myac2 (6mya C:330-491)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3041799Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 3041800Protein automated matches [254645] (42 species)
    not a true protein
  7. 3042016Species Influenza A virus, different strains [TaxId:11320] [255657] (9 PDB entries)
  8. 3042019Domain d6myac2: 6mya C:330-491 [360264]
    Other proteins in same PDB: d6myaa1, d6myaa3, d6myab1, d6myac1, d6myad1, d6myae1, d6myae3, d6myaf1
    automated match to d4wsrd2
    complexed with edo, nag, peg

Details for d6myac2

PDB Entry: 6mya (more details), 2.05 Å

PDB Description: crystal structure of invbp.18715.a.kn11: influenza hemagglutinin from strain a/almaty/32/1998
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d6myac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6myac2 h.3.1.0 (C:330-491) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
tqfttvgkefnnlekrmenlnkkvddgfldiwtynaellvllenertldfhdsnvknlye
kvksqlknnakeigngcfefyhkcdnecmesvrngtydypky

SCOPe Domain Coordinates for d6myac2:

Click to download the PDB-style file with coordinates for d6myac2.
(The format of our PDB-style files is described here.)

Timeline for d6myac2: