![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
![]() | Domain d6fysd_: 6fys D: [360228] automated match to d5hggs_ complexed with edo |
PDB Entry: 6fys (more details), 2 Å
SCOPe Domain Sequences for d6fysd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fysd_ b.1.1.1 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]} vqlvesggglvqpggslrlscaatgftlenkaigwfrqtpgseregvlcisksgswtyyt dsmrgrftisrdnaentvylqmdslkpedtavyycatttaggglcwdgttfsrlasswgq gtqvtvs
Timeline for d6fysd_: