SCOPe 2.08: Domain d5zz7b2: 5zz7 B:80-208

Lineage for d5zz7b2 (5zz7 B:80-208)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [224971] (9 PDB entries)

8. Domain d5zz7b2: 5zz7 B:80-208 [360052]
   Other proteins in same PDB: d5zz7a1, d5zz7b1
   automated match to d1xcba2
   complexed with gol, nai

Details for d5zz7b2

PDB Entry: 5zz7, 2.45 Å

PDB Description: redox-sensing transcriptional repressor rex

PDB Compounds: (B:) Redox-sensing transcriptional repressor Rex 1

SCOPe Domain Sequences for d5zz7b2:

Sequence; same for both SEQRES and ATOM records:

>d5zz7b2 c.2.1.0 (B:80-208) automated matches {Thermotoga maritima [TaxId: 243274]}
kkewklvvvgagnigravanytvmkekgfriigifdsdpskigkeaapgltvsdvselek
fveehgveigviavpaehaqeiaerlekagikgilnfapvkikvsvpveniditaslrvl
tfeivrrns

Timeline for d5zz7b2:

• d5zz7b2 first appeared in SCOPe 2.07