| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Thermotoga maritima [TaxId:243274] [224971] (9 PDB entries) |
| Domain d5zz7b2: 5zz7 B:80-208 [360052] Other proteins in same PDB: d5zz7a1, d5zz7b1 automated match to d1xcba2 complexed with gol, nai |
PDB Entry: 5zz7 (more details), 2.45 Å
SCOPe Domain Sequences for d5zz7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zz7b2 c.2.1.0 (B:80-208) automated matches {Thermotoga maritima [TaxId: 243274]}
kkewklvvvgagnigravanytvmkekgfriigifdsdpskigkeaapgltvsdvselek
fveehgveigviavpaehaqeiaerlekagikgilnfapvkikvsvpveniditaslrvl
tfeivrrns
Timeline for d5zz7b2: