Lineage for d6gwvj_ (6gwv J:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2512581Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2512582Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2512735Family c.73.1.0: automated matches [191466] (1 protein)
    not a true family
  6. 2512736Protein automated matches [190728] (15 species)
    not a true protein
  7. 2512737Species Azotobacter vinelandii [TaxId:322710] [258948] (13 PDB entries)
  8. 2512756Domain d6gwvj_: 6gwv J: [359943]
    automated match to d2ogxa_
    complexed with atp, cl, so4

Details for d6gwvj_

PDB Entry: 6gwv (more details), 2.8 Å

PDB Description: molybdenum storage protein without polymolybdate clusters and atp
PDB Compounds: (J:) Molybdenum storage protein subunit alpha

SCOPe Domain Sequences for d6gwvj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gwvj_ c.73.1.0 (J:) automated matches {Azotobacter vinelandii [TaxId: 322710]}
rpirllpwlqvvkiggrvmdrgadailplveelrkllpehrlliltgagvrarhvfsvgl
dlglpvgslaplaaseagqnghilaamlasegvsyvehptvadqlaihlsatravvgsaf
ppyhhhefpgsripphradtgaflladafgaagltivenvdgiytadpngpdrgqarflp
etsatdlaksegplpvdralldvmatarhiervqvvnglvpgrltaalrgehvgtlirtg
vrpa

SCOPe Domain Coordinates for d6gwvj_:

Click to download the PDB-style file with coordinates for d6gwvj_.
(The format of our PDB-style files is described here.)

Timeline for d6gwvj_: