Lineage for d1bq6a2 (1bq6 A:236-389)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1626713Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1626714Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1627154Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
  6. 1627216Protein Chalcone synthase [53915] (1 species)
  7. 1627217Species Alfalfa (Medicago sativa) [TaxId:3879] [53916] (16 PDB entries)
    Uniprot P30074
  8. 1627227Domain d1bq6a2: 1bq6 A:236-389 [35988]
    complexed with coa, so4

Details for d1bq6a2

PDB Entry: 1bq6 (more details), 1.56 Å

PDB Description: chalcone synthase from alfalfa with coenzyme a
PDB Compounds: (A:) chalcone synthase

SCOPe Domain Sequences for d1bq6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bq6a2 c.95.1.2 (A:236-389) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]}
ifemvwtaqtiapdsegaidghlreagltfhllkdvpgivsknitkalveafeplgisdy
nsifwiahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstq
nglkttgeglewgvlfgfgpgltietvvlrsvai

SCOPe Domain Coordinates for d1bq6a2:

Click to download the PDB-style file with coordinates for d1bq6a2.
(The format of our PDB-style files is described here.)

Timeline for d1bq6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bq6a1