Lineage for d1hnha2 (1hnh A:175-317)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 128395Fold c.95: Thiolase-like [53900] (1 superfamily)
  4. 128396Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 128397Family c.95.1.1: Thiolase-related [53902] (5 proteins)
  6. 128491Protein Ketoacyl-ACP synthase III (FabH) [53912] (2 species)
  7. 128492Species Escherichia coli [TaxId:562] [53913] (6 PDB entries)
  8. 128508Domain d1hnha2: 1hnh A:175-317 [35984]

Details for d1hnha2

PDB Entry: 1hnh (more details), 1.9 Å

PDB Description: crystal structure of beta-ketoacyl-acp synthase iii + degraded form of acetyl-coa

SCOP Domain Sequences for d1hnha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnha2 c.95.1.1 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli}
isthlhadgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannld
rsqldwlvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrik
pgqlvlleafgggftwgsalvrf

SCOP Domain Coordinates for d1hnha2:

Click to download the PDB-style file with coordinates for d1hnha2.
(The format of our PDB-style files is described here.)

Timeline for d1hnha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hnha1