Lineage for d6bfyd1 (6bfy D:0-139)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2555105Species Escherichia coli [TaxId:562] [359490] (4 PDB entries)
  8. 2555109Domain d6bfyd1: 6bfy D:0-139 [359696]
    Other proteins in same PDB: d6bfya2, d6bfya3, d6bfyb2, d6bfyb3, d6bfyc2, d6bfyc3, d6bfyd2, d6bfyd3, d6bfye2, d6bfye3, d6bfyf2, d6bfyf3
    automated match to d2fyma2
    complexed with 2pg, gol, mg, so4

Details for d6bfyd1

PDB Entry: 6bfy (more details), 1.81 Å

PDB Description: crystal structure of enolase from escherichia coli with bound 2- phosphoglycerate substrate
PDB Compounds: (D:) enolase

SCOPe Domain Sequences for d6bfyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bfyd1 d.54.1.0 (D:0-139) automated matches {Escherichia coli [TaxId: 562]}
mskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrfl
gkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanak
aaaaakgmplyehiaelngt

SCOPe Domain Coordinates for d6bfyd1:

Click to download the PDB-style file with coordinates for d6bfyd1.
(The format of our PDB-style files is described here.)

Timeline for d6bfyd1: