SCOPe 2.08: Domain d6bgta2: 6bgt A:107-211

Lineage for d6bgta2 (6bgt A:107-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6bgta2: 6bgt A:107-211 [359690]
   Other proteins in same PDB: d6bgta1, d6bgtb_, d6bgtc1, d6bgtc2, d6bgtc3, d6bgtc4
   automated match to d1dn0a2
   complexed with nag; mutant

Details for d6bgta2

PDB Entry: 6bgt, 2.7 Å

PDB Description: structure of trastuzumab fab mutant in complex with her2 extracellular domain

PDB Compounds: (A:) Herceptin light chain mutant

SCOPe Domain Sequences for d6bgta2:

Sequence; same for both SEQRES and ATOM records:

>d6bgta2 b.1.1.2 (A:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d6bgta2:

• d6bgta2 first appeared in SCOPe 2.07