Lineage for d6bgta2 (6bgt A:107-211)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751311Domain d6bgta2: 6bgt A:107-211 [359690]
    Other proteins in same PDB: d6bgta1, d6bgtb_, d6bgtc1, d6bgtc2, d6bgtc3, d6bgtc4
    automated match to d1dn0a2
    complexed with nag; mutant

Details for d6bgta2

PDB Entry: 6bgt (more details), 2.7 Å

PDB Description: structure of trastuzumab fab mutant in complex with her2 extracellular domain
PDB Compounds: (A:) Herceptin light chain mutant

SCOPe Domain Sequences for d6bgta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bgta2 b.1.1.2 (A:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d6bgta2:

Click to download the PDB-style file with coordinates for d6bgta2.
(The format of our PDB-style files is described here.)

Timeline for d6bgta2: