SCOPe 2.08: Domain d6frme2: 6frm E:256-407

Lineage for d6frme2 (6frm E:256-407)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (31 species)
   not a true protein

7. Species Methanothermococcus thermolithotrophicus [TaxId:2186] [358263] (4 PDB entries)

8. Domain d6frme2: 6frm E:256-407 [359680]
   Other proteins in same PDB: d6frma1, d6frmb1, d6frmc1, d6frmd1, d6frme1, d6frmf1, d6frmg1, d6frmh1
   automated match to d2ohha2
   complexed with 7mt, cl, fe, fmn, tb

Details for d6frme2

PDB Entry: 6frm, 2.2 Å

PDB Description: crystal structure of coenzyme f420h2 oxidase (fpra) co-crystallized with 10 mm tb-xo4

PDB Compounds: (E:) Coenzyme F420H2 oxidase (FprA)

SCOPe Domain Sequences for d6frme2:

Sequence; same for both SEQRES and ATOM records:

>d6frme2 c.23.5.0 (E:256-407) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 2186]}
ckdkvtivydtmhgstqkmahafaegimsegvdvkmyflhnderseivkdildskafllg
aptiydepfpsvgdliyylkglkfnrtglkrlalafgsmggngggtkvlaeklkecgfev
ldeyelyyvptedelekcynmgkrlavkvkem

Timeline for d6frme2:

• d6frme2 first appeared in SCOPe 2.07