Lineage for d6frme2 (6frm E:256-407)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856900Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2856901Protein automated matches [190158] (31 species)
    not a true protein
  7. 2857022Species Methanothermococcus thermolithotrophicus [TaxId:2186] [358263] (4 PDB entries)
  8. 2857041Domain d6frme2: 6frm E:256-407 [359680]
    Other proteins in same PDB: d6frma1, d6frmb1, d6frmc1, d6frmd1, d6frme1, d6frmf1, d6frmg1, d6frmh1
    automated match to d2ohha2
    complexed with 7mt, cl, fe, fmn, tb

Details for d6frme2

PDB Entry: 6frm (more details), 2.2 Å

PDB Description: crystal structure of coenzyme f420h2 oxidase (fpra) co-crystallized with 10 mm tb-xo4
PDB Compounds: (E:) Coenzyme F420H2 oxidase (FprA)

SCOPe Domain Sequences for d6frme2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6frme2 c.23.5.0 (E:256-407) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 2186]}
ckdkvtivydtmhgstqkmahafaegimsegvdvkmyflhnderseivkdildskafllg
aptiydepfpsvgdliyylkglkfnrtglkrlalafgsmggngggtkvlaeklkecgfev
ldeyelyyvptedelekcynmgkrlavkvkem

SCOPe Domain Coordinates for d6frme2:

Click to download the PDB-style file with coordinates for d6frme2.
(The format of our PDB-style files is described here.)

Timeline for d6frme2: