Lineage for d1dd8d2 (1dd8 D:254-406)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1626713Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1626714Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1626715Family c.95.1.1: Thiolase-related [53902] (9 proteins)
  6. 1626736Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)
  7. 1626737Species Escherichia coli [TaxId:562] [53908] (17 PDB entries)
    Uniprot P14926
  8. 1626801Domain d1dd8d2: 1dd8 D:254-406 [35939]

Details for d1dd8d2

PDB Entry: 1dd8 (more details), 2.3 Å

PDB Description: crystal structure of beta-ketoacyl-[acyl carrier protein] synthase i from escherichia coli
PDB Compounds: (D:) beta-ketoacyl [acyl carrier protein] synthase I

SCOPe Domain Sequences for d1dd8d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dd8d2 c.95.1.1 (D:254-406) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd

SCOPe Domain Coordinates for d1dd8d2:

Click to download the PDB-style file with coordinates for d1dd8d2.
(The format of our PDB-style files is described here.)

Timeline for d1dd8d2: