SCOPe 2.08: Domain d5ynaa5: 5yna A:966-1083

Lineage for d5ynaa5 (5yna A:966-1083)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [359378] (10 PDB entries)

8. Domain d5ynaa5: 5yna A:966-1083 [359387]
   Other proteins in same PDB: d5ynaa1, d5ynaa2, d5ynaa3, d5ynaa4
   automated match to d2fhfa4
   complexed with act, ca, gol, peg

Details for d5ynaa5

PDB Entry: 5yna, 1.96 Å

PDB Description: crystal structure of pullulanase from klebsiella pneumoniae complex at 1 mm alpha-cyclodextrin

PDB Compounds: (A:) PulA protein

SCOPe Domain Sequences for d5ynaa5:

Sequence; same for both SEQRES and ATOM records:

>d5ynaa5 b.71.1.0 (A:966-1083) automated matches {Klebsiella pneumoniae [TaxId: 573]}
dgatvmkrvdfrntgadqqtgllvmtiddgmqagasldsrvdgivvainaapesrtlqdf
agtslqlsaiqqaagdrslasgvqvaadgsvtlpawsvavlelpqgesqgaglpvssk

Timeline for d5ynaa5:

• d5ynaa5 first appeared in SCOPe 2.07