Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (161 species) not a true protein |
Species Psychrobacter arcticus [TaxId:259536] [338566] (12 PDB entries) |
Domain d6fuad_: 6fua D: [359252] automated match to d5m8hf_ complexed with adp, cl, mg, prp |
PDB Entry: 6fua (more details), 2.8 Å
SCOPe Domain Sequences for d6fuad_:
Sequence, based on SEQRES records: (download)
>d6fuad_ c.94.1.0 (D:) automated matches {Psychrobacter arcticus [TaxId: 259536]} eflgltlalskgrileetmpllraagvelledpeasrklifptsnpnvrvlilrasdvpt yvehgaadfgvagkdvllehganhvyelldlkiaqcklmtagvkdaplpnrrlriatkyv nvarayfasqgqqvdviklygsmelaplvglgdlivdvvdtgntlrangleardhicdvs srlivnqvsykrkfallepildsfknsin
>d6fuad_ c.94.1.0 (D:) automated matches {Psychrobacter arcticus [TaxId: 259536]} eflgltlalskgrileetmpllraagvelledklifptsnpnvrvlilrasdvptyvehg aadfgvagkdvllehganhvyelldlkiaqcklmtagvkdaplpnrrlriatkyvnvara yfasqgqqvdviklygsmelaplvglgdlivdvvdtgntlrangleardhicdvssrliv nqvsykrkfallepildsfknsin
Timeline for d6fuad_: