PDB entry 6fua

View 6fua on RCSB PDB site
Description: ATP phosphoribosyltransferase (HisZG ATPPRT) from Psychrobacter arcticus in complex with PRPP and ADP
Class: transferase
Keywords: ATP phosphoribosyltransferase, HisZG, cold-adapted, transferase
Deposited on 2018-02-26, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP phosphoribosyltransferase regulatory subunit
    Species: Psychrobacter arcticus (strain DSM 17307 / 273-4) [TaxId:259536]
    Gene: hisZ, Psyc_0676
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4FTX3 (1-387)
      • expression tag (0)
  • Chain 'B':
    Compound: ATP phosphoribosyltransferase regulatory subunit
    Species: Psychrobacter arcticus (strain DSM 17307 / 273-4) [TaxId:259536]
    Gene: hisZ, Psyc_0676
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ATP phosphoribosyltransferase
    Species: Psychrobacter arcticus (strain DSM 17307 / 273-4) [TaxId:259536]
    Gene: hisG, Psyc_1903
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fuac_
  • Chain 'D':
    Compound: ATP phosphoribosyltransferase
    Species: Psychrobacter arcticus (strain DSM 17307 / 273-4) [TaxId:259536]
    Gene: hisG, Psyc_1903
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fuad_
  • Heterogens: ADP, PRP, CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6fuaC (C:)
    gmtevtnslptsgllneandeflgltlalskgrileetmpllraagvelledpeasrkli
    fptsnpnvrvlilrasdvptyvehgaadfgvagkdvllehganhvyelldlkiaqcklmt
    agvkdaplpnrrlriatkyvnvarayfasqgqqvdviklygsmelaplvglgdlivdvvd
    tgntlrangleardhicdvssrlivnqvsykrkfallepildsfknsinsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fuaC (C:)
    flgltlalskgrileetmpllraagvelledpeaslifptsnpnvrvlilrasdvptyve
    hgaadfgvagkdvllehganhvyelldlkiaqcklmtagvkdaplpnrrlriatkyvnva
    rayfasqgqqvdviklygsmelaplvglgdlivdvvdtgntlrangleardhicdvssrl
    ivnqvsykrkfallepildsfknsi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6fuaD (D:)
    gmtevtnslptsgllneandeflgltlalskgrileetmpllraagvelledpeasrkli
    fptsnpnvrvlilrasdvptyvehgaadfgvagkdvllehganhvyelldlkiaqcklmt
    agvkdaplpnrrlriatkyvnvarayfasqgqqvdviklygsmelaplvglgdlivdvvd
    tgntlrangleardhicdvssrlivnqvsykrkfallepildsfknsinsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fuaD (D:)
    eflgltlalskgrileetmpllraagvelledklifptsnpnvrvlilrasdvptyvehg
    aadfgvagkdvllehganhvyelldlkiaqcklmtagvkdaplpnrrlriatkyvnvara
    yfasqgqqvdviklygsmelaplvglgdlivdvvdtgntlrangleardhicdvssrliv
    nqvsykrkfallepildsfknsin