SCOPe 2.07: Domain d6flcg_: 6flc G:

Lineage for d6flcg_ (6flc G:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)

6. Protein automated matches [190183] (10 species)
   not a true protein

7. Species Dengue virus 2 [TaxId:11060] [359240] (2 PDB entries)

8. Domain d6flcg_: 6flc G: [359241]
   Other proteins in same PDB: d6flca1, d6flca2, d6flcl1, d6flcl2
   automated match to d3uzva_
   complexed with gol

Details for d6flcg_

PDB Entry: 6flc, 2 Å

PDB Description: 2c8 fab bound to ediii of denv 2

PDB Compounds: (G:) Domain III of Dengue virus 2

SCOPe Domain Sequences for d6flcg_:

Sequence; same for both SEQRES and ATOM records:

>d6flcg_ b.1.18.4 (G:) automated matches {Dengue virus 2 [TaxId: 11060]}
msysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnp
ivtekdspvnieaeppfgdsyiiigvepgqlklnwfkk

Timeline for d6flcg_:

• d6flcg_ is new in SCOPe 2.07-stable
  
• d6flcg_ appears in the current release, SCOPe 2.08