Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) |
Superfamily c.95.1: Thiolase-like [53901] (2 families) |
Family c.95.1.1: Thiolase-related [53902] (5 proteins) |
Protein Biosynthetic thiolase [53905] (1 species) |
Species Zoogloea ramigera [TaxId:350] [53906] (4 PDB entries) |
Domain d1dlud2: 1dlu D:269-392 [35923] |
PDB Entry: 1dlu (more details), 2.25 Å
SCOP Domain Sequences for d1dlud2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dlud2 c.95.1.1 (D:269-392) Biosynthetic thiolase {Zoogloea ramigera} iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaneafaaqacavnk dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc iesl
Timeline for d1dlud2: