SCOPe 2.07: Domain d6ddva1: 6ddv A:1-107

Lineage for d6ddva1 (6ddv A:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)

8. Domain d6ddva1: 6ddv A:1-107 [359217]
   Other proteins in same PDB: d6ddva2
   automated match to d1t66c1

Details for d6ddva1

PDB Entry: 6ddv, 2.05 Å

PDB Description: crystal structure analysis of the epitope of an anti-mica antibody

PDB Compounds: (A:) Anti-MICA Fab fragment light chain clone 6E1

SCOPe Domain Sequences for d6ddva1:

Sequence; same for both SEQRES and ATOM records:

>d6ddva1 b.1.1.1 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqtplslpvslgdqasiscrssqhivhsnentylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpwtfgggtkleik

Timeline for d6ddva1:

• d6ddva1 is new in SCOPe 2.07-stable
  
• d6ddva1 appears in the current release, SCOPe 2.08