SCOPe 2.08: Domain d6g3sa1: 6g3s A:4-188

Lineage for d6g3sa1 (6g3s A:4-188)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53071] (7 PDB entries)

8. Domain d6g3sa1: 6g3s A:4-188 [359083]
   automated match to d1hjoa1
   complexed with adp, mg, na, po4, tew

Details for d6g3sa1

PDB Entry: 6g3s, 2.3 Å

PDB Description: structure of tellurium-centred anderson-evans polyoxotungstate (tew) bound to the nucleotide binding domain of hsp70. second structure of two tew-hsp70 structures deposited.

PDB Compounds: (A:) heat shock 70 kda protein 1a

SCOPe Domain Sequences for d6g3sa1:

Sequence; same for both SEQRES and ATOM records:

>d6g3sa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Human (Homo sapiens) [TaxId: 9606]}
aaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvalnp
qntvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeissmv
ltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaaiay
gldrt

Timeline for d6g3sa1:

• d6g3sa1 first appeared in SCOPe 2.07