PDB entry 6g3s

View 6g3s on RCSB PDB site
Description: Structure of tellurium-centred Anderson-Evans polyoxotungstate (TEW) bound to the nucleotide binding domain of HSP70. Second structure of two TEW-HSP70 structures deposited.
Class: chaperone
Keywords: ATPase domain, CHAPERONE
Deposited on 2018-03-26, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat shock 70 kda protein 1a
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPA1A, HSP72, HSPA1, HSX70
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g3sa1, d6g3sa2
  • Heterogens: ADP, MG, PO4, NA, TEW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g3sA (A:)
    kaaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvaln
    pqntvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeissm
    vltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaaia
    ygldrtgkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnhfv
    eefkrkhkkdisqnkravrrlrtacerakrtlssstqasleidslfegidfytsitrarf
    eelcsdlfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdlnks
    inpdeavaygaavqaailmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g3sA (A:)
    aaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvalnp
    qntvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeissmv
    ltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaaiay
    gldrtgkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnhfve
    efkrkhkkdisqnkravrrlrtacerakrtlssstqasleidslfegidfytsitrarfe
    elcsdlfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdlnksi
    npdeavaygaavqaailmg