SCOP 1.71: Domain d1pxta1: 1pxt A:28-293

Lineage for d1pxta1 (1pxt A:28-293)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.1: Thiolase-related [53902] (8 proteins)

6. Protein Thiolase [53903] (1 species)
   topology of each domain is similar to the first domain of phosphoglucomutase

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53904] (2 PDB entries)

8. Domain d1pxta1: 1pxt A:28-293 [35904]

Details for d1pxta1

PDB Entry: 1pxt, 2.8 Å

PDB Description: the 2.8 angstroms structure of peroxisomal 3-ketoacyl-coa thiolase of saccharomyces cerevisiae: a five layered a-b-a-b-a structure, constructed from two core domains of identical topology

SCOP Domain Sequences for d1pxta1:

Sequence, based on SEQRES records:

>d1pxta1 c.95.1.1 (A:28-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae)}
llekrpedvvivaanrsaigkgfkgafkdvntdyllynflnefigrfpeplradlnliee
vacgnvlnvgagatehraaclasgipystpfvalnrqcssgltavndiankikvgqidig
lalgvesmtnnyknvnplgmisseelqknreakkclipmgitnenvaanfkisrkdqdef
aansyqkaykakneglfedeilpiklpdgsicqsdegprpnvtaeslssirpafikdrgt
ttagnasqvsdgvagvllarrsvanq

Sequence, based on observed residues (ATOM records):

>d1pxta1 c.95.1.1 (A:28-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae)}
llekrpedvvivaanrsaigkgfkgafkdvntdyllynflnefigrfpeplradlnliee
vacgnvlnvgagatehraaclasgipystpfvalnrqcssgltavndiankikvgqidig
lalgvesmtnnyknqknreakkclipmgitnenrkdqdefaansyqkaykakneglfede
ilpiklpdgsicqsdegprpqvsdgvagvllarrsvanq

Timeline for d1pxta1:

• d1pxta1 first appeared (with stable ids) in SCOP 1.55
  
• d1pxta1 appears in SCOP 1.69
  
• d1pxta1 appears in SCOP 1.73
  
• d1pxta1 appears in the current release, SCOPe 2.08