SCOP 1.75: Domain d1afwb2: 1afw B:294-417

Lineage for d1afwb2 (1afw B:294-417)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.1: Thiolase-related [53902] (8 proteins)

6. Protein Thiolase [53903] (1 species)
   topology of each domain is similar to the first domain of phosphoglucomutase

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53904] (2 PDB entries)

8. Domain d1afwb2: 1afw B:294-417 [35903]
   complexed with mpd

Details for d1afwb2

PDB Entry: 1afw, 1.8 Å

PDB Description: the 1.8 angstrom crystal structure of the dimeric peroxisomal thiolase of saccharomyces cerevisiae

PDB Compounds: (B:) 3-ketoacetyl-coa thiolase

SCOP Domain Sequences for d1afwb2:

Sequence; same for both SEQRES and ATOM records:

>d1afwb2 c.95.1.1 (B:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lnlpvlgryidfqtvgvppeimgvgpayaipkvleatglqvqdidifeineafaaqalyc
ihklgidlnkvnprggaialghplgctgarqvatilrelkkdqigvvsmcigtgmgaaai
fike

Timeline for d1afwb2:

• d1afwb2 first appeared (with stable ids) in SCOP 1.55
  
• d1afwb2 appears in SCOP 1.73
  
• d1afwb2 appears in SCOPe 2.01
  
• d1afwb2 appears in the current release, SCOPe 2.08