Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (2 families) |
Family c.95.1.1: Thiolase-related [53902] (8 proteins) |
Protein Thiolase [53903] (1 species) topology of each domain is similar to the first domain of phosphoglucomutase |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53904] (2 PDB entries) |
Domain d1afwa2: 1afw A:294-417 [35901] |
PDB Entry: 1afw (more details), 1.8 Å
SCOP Domain Sequences for d1afwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1afwa2 c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lnlpvlgryidfqtvgvppeimgvgpayaipkvleatglqvqdidifeineafaaqalyc ihklgidlnkvnprggaialghplgctgarqvatilrelkkdqigvvsmcigtgmgaaai fike
Timeline for d1afwa2: