SCOPe 2.08: Domain d1btja_: 1btj A:

Lineage for d1btja_ (1btj A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (4 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Transferrin [53897] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53899] (20 PDB entries)

8. Domain d1btja_: 1btj A: [35898]
   N-terminal lobe

Details for d1btja_

PDB Entry: 1btj, 3.2 Å

PDB Description: human serum transferrin, recombinant n-terminal lobe, apo form, crystal form 2

PDB Compounds: (A:) protein (serum transferrin)

SCOPe Domain Sequences for d1btja_:

Sequence; same for both SEQRES and ATOM records:

>d1btja_ c.94.1.2 (A:) Transferrin {Human (Homo sapiens) [TaxId: 9606]}
ktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtld
aglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtglg
rsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstln
qyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdchl
aqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgfl
kvpprmdakmylgyeyvtairnlregtcpeapt

Timeline for d1btja_:

• d1btja_ first appeared (with stable ids) in SCOP 1.55
  
• d1btja_ appears in SCOPe 2.07