SCOPe 2.07: Domain d6badc1: 6bad C:1-159

Lineage for d6badc1 (6bad C:1-159)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (19 species)

7. Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (38 PDB entries)

8. Domain d6badc1: 6bad C:1-159 [358960]
   Other proteins in same PDB: d6bada2, d6badb2, d6badc2, d6badd2
   automated match to d1i10d1
   complexed with d0y, epe, nad, so4

Details for d6badc1

PDB Entry: 6bad, 2.1 Å

PDB Description: lactate dehydrogenase in complex with inhibitor (r)-3-((2- chlorophenyl)thio)-6-(3-((4-fluorophenyl)amino)phenyl)-4-hydroxy-6- (thiophen-3-yl)-5,6-dihydro-2h-pyran-2-one

PDB Compounds: (C:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d6badc1:

Sequence; same for both SEQRES and ATOM records:

>d6badc1 c.2.1.5 (C:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

Timeline for d6badc1:

• d6badc1 is new in SCOPe 2.07-stable
  
• d6badc1 appears in the current release, SCOPe 2.08