SCOPe 2.08: Domain d6dxdc1: 6dxd C:7-241

Lineage for d6dxdc1 (6dxd C:7-241)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)

6. Protein automated matches [226868] (6 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [358856] (3 PDB entries)

8. Domain d6dxdc1: 6dxd C:7-241 [358888]
   automated match to d1cmla1
   complexed with csd; mutant

Details for d6dxdc1

PDB Entry: 6dxd, 1.59 Å

PDB Description: crystal structure of chalcone synthase from arabidopsis thaliana - c347s mutant

PDB Compounds: (C:) chalcone synthase

SCOPe Domain Sequences for d6dxdc1:

Sequence; same for both SEQRES and ATOM records:

>d6dxdc1 c.95.1.2 (C:7-241) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ssldeirqaqradgpagilaigtanpenhvlqaeypdyyfritnsehmtdlkekfkrmcd
kstirkrhmhlteeflkenphmcaymapsldtrqdivvvevpklgkeaavkaikewgqpk
skithvvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcfaggtvlriakdlaenn
rgarvlvvcseitavtfrgpsdthldslvgqalfsdgaaalivgsdpdtsvgekp

Timeline for d6dxdc1:

• d6dxdc1 first appeared in SCOPe 2.07