Lineage for d6dxdc1 (6dxd C:7-241)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916987Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)
  6. 2917278Protein automated matches [226868] (6 species)
    not a true protein
  7. 2917302Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [358856] (3 PDB entries)
  8. 2917315Domain d6dxdc1: 6dxd C:7-241 [358888]
    automated match to d1cmla1
    complexed with csd; mutant

Details for d6dxdc1

PDB Entry: 6dxd (more details), 1.59 Å

PDB Description: crystal structure of chalcone synthase from arabidopsis thaliana - c347s mutant
PDB Compounds: (C:) chalcone synthase

SCOPe Domain Sequences for d6dxdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dxdc1 c.95.1.2 (C:7-241) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ssldeirqaqradgpagilaigtanpenhvlqaeypdyyfritnsehmtdlkekfkrmcd
kstirkrhmhlteeflkenphmcaymapsldtrqdivvvevpklgkeaavkaikewgqpk
skithvvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcfaggtvlriakdlaenn
rgarvlvvcseitavtfrgpsdthldslvgqalfsdgaaalivgsdpdtsvgekp

SCOPe Domain Coordinates for d6dxdc1:

Click to download the PDB-style file with coordinates for d6dxdc1.
(The format of our PDB-style files is described here.)

Timeline for d6dxdc1: