Lineage for d1tfda_ (1tfd A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145370Family c.94.1.2: Transferrin [53888] (4 protein domains)
    further duplication: composed of two two-domain lobes
  6. 2145478Protein Transferrin [53897] (3 species)
  7. 2145509Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53898] (2 PDB entries)
  8. 2145512Domain d1tfda_: 1tfd A: [35887]
    N-terminal lobe
    complexed with co3, fe

Details for d1tfda_

PDB Entry: 1tfd (more details), 2.3 Å

PDB Description: high-resolution x-ray studies on rabbit serum transferrin: preliminary structure analysis of the n-terminal half-molecule at 2.3 angstroms resolution
PDB Compounds: (A:) transferrin

SCOPe Domain Sequences for d1tfda_:

Sequence, based on SEQRES records: (download)

>d1tfda_ c.94.1.2 (A:) Transferrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
vrwcavndheaskcanfrdsmkkvlpedgpriicvkkasyldcikaiaaheadavtldag
lvheagltpnnlkpvvaefygskenpktfyyavalvkkgsnfqlnelqgkkschtglgrs
agwnipigllycdlpeprkplekavasffsgscvpcadgadfpqlcqlcpgcgcsssqpy
fgysgafkclkdglgdvafvkqetifenlpskderdqyellcldntrkpvdeyeqchlar
vpshavvarsvdgkedliwellnqaqehfgkdksgdfqlfssphgknllfkdsaygffk

Sequence, based on observed residues (ATOM records): (download)

>d1tfda_ c.94.1.2 (A:) Transferrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
vrwcavndheaskcanfrdsmkkvlpedgpriicvkkasyldcikaiaaheadavtldag
lvheagltpnnlkpvvaefygskenpktfyyavalvkkgsnfqlnelqgkkschtglgrs
agwnipigllycdlpeprkplekavasffsgscvpcadqlcqlcpgcgcsssqpyfgysg
afkclkdglgdvafvkqetifenlpskderdqyellcldntrkpvdeyeqchlarvpsha
vvarsvdgkedliwellnqaqehfgkdksgdfqlfssphgknllfkdsaygffk

SCOPe Domain Coordinates for d1tfda_:

Click to download the PDB-style file with coordinates for d1tfda_.
(The format of our PDB-style files is described here.)

Timeline for d1tfda_: