SCOPe 2.04: Domain d1lgbc_: 1lgb C:

Lineage for d1lgbc_ (1lgb C:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (4 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Lactoferrin [53889] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53890] (22 PDB entries)

8. Domain d1lgbc_: 1lgb C: [35858]
   Other proteins in same PDB: d1lgb.1
   N2-fragment (one domain fragment)
   complexed with ca, mn

Details for d1lgbc_

PDB Entry: 1lgb, 3.3 Å

PDB Description: interaction of a legume lectin with the n2 fragment of human lactotransferrin or with the isolated biantennary glycopeptide: role of the fucose moiety

PDB Compounds: (C:) lactotransferrin (n2 fragment)

SCOPe Domain Sequences for d1lgbc_:

Sequence; same for both SEQRES and ATOM records:

>d1lgbc_ c.94.1.2 (C:) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]}
hyyavavvkkggsfqlnelqglkschtglrrtagwnvpigtlrpflnwtgppepieaava
rffsascvpgadkgqfpnlcrlcagtgenkcafssqepyfsysgafkclkdgagdvafir
estvfedlsdeaerdeyellcpdntrkpvdkfkdchlar

Timeline for d1lgbc_:

• d1lgbc_ first appeared (with stable ids) in SCOP 1.55
  
• d1lgbc_ appears in SCOPe 2.03
  
• d1lgbc_ appears in SCOPe 2.05
  
• d1lgbc_ appears in the current release, SCOPe 2.08